| Desktop | 0/100 | ✘ |
| Mobile | 71/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 46 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 3257 / 47350 (bytes) = 6.88% | ❗ |
| Load Time | 0.87 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 25 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 19 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| click | 7 | ✘ | ✘ | ✘ |
| here | 7 | ✘ | ✘ | ✘ |
| health | 6 | ✘ | ✘ | ✘ |
| pharmacy | 6 | ✔ | ✔ | ✘ |
| prescription | 5 | ✘ | ✘ | ✘ |
| queen | 5 | ✔ | ✔ | ✘ |
| medication | 4 | ✘ | ✔ | ✘ |
| pharmacist | 3 | ✘ | ✘ | ✘ |
| customer | 3 | ✘ | ✘ | ✘ |
| services | 3 | ✘ | ✔ | ✘ |
| medicine | 3 | ✘ | ✘ | ✘ |
| easy | 3 | ✘ | ✘ | ✘ |
| stay | 3 | ✘ | ✘ | ✘ |
| adherence | 2 | ✘ | ✘ | ✘ |
| will | 2 | ✘ | ✘ | ✘ |
|
With 0.87 seconds in page load, 46 KB of page size and all other reports below, the healthfirstpharmacyservices.com has a SEO score of 57 out of 100 |
| Title | Retail Pharmacy in Houston, TX | THE QUEEN LLC |
| Description | THE QUEEN LLC is a pharmacy in Houston, TX offering an array of services, including medication therapy management, non-sterile compounding, and more. |
| Keyword |
| Age | 0 Years, 5 Days |
| Created | 26th-Oct-2022 |
| Updated | 26th-Oct-2022 |
| Expiry | 26th-Oct-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| healthfirstpharmacyservices.com | A | 14390 | ip:44.237.241.111 |
| healthfirstpharmacyservices.com | NS | 86400 | target:ns2.bluehost.com |
| healthfirstpharmacyservices.com | NS | 86400 | target:ns1.bluehost.com |
| healthfirstpharmacyservices.com | SOA | 86400 | mname:ns1.bluehost.comrname:dnsadmin.bluehost.comserial:2022102602refresh:86400retry:7200expire:3600000minimum-ttl:300 |
|
Domain Name: HEALTHFIRSTPHARMACYSERVICES.COM Registry Domain ID: 10057336 Registrar WHOIS Server: whois.bluehost.com Registrar URL: http://www.bluehost.com/ Updated Date: 2022-10-26T16:53:47Z Creation Date: 2022-10-26T16:53:45Z Registrar Registration Expiration Date: 2023-10-26T16:53:45Z Registrar: FastDomain Inc. Registrar IANA ID: 1154 Registrar Abuse Contact Email: tos@fastdomain.com Registrar Abuse Contact Phone: 888-210-3278 Reseller: BlueHost.Com Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: FAST-111369499 Registrant Name: DOMAIN ADMIN Registrant Organization: DOMAIN PRIVACY SERVICE FBO REGISTRANT Registrant Street: 5335 GATE PKWY. Registrant City: JACKSONVILLE Registrant State/Province: FLORIDA Registrant Postal Code: 32256 Registrant Country: US Registrant Phone: +1.8017659400 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: WHOIS@BLUEHOST.COM Registry Admin ID: FAST-111369499 Admin Name: DOMAIN ADMIN Admin Organization: DOMAIN PRIVACY SERVICE FBO REGISTRANT Admin Street: 5335 GATE PKWY. Admin City: JACKSONVILLE Admin State/Province: FLORIDA Admin Postal Code: 32256 Admin Country: US Admin Phone: +1.8017659400 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: WHOIS@BLUEHOST.COM Registry Tech ID: FAST-111369499 Tech Name: DOMAIN ADMIN Tech Organization: DOMAIN PRIVACY SERVICE FBO REGISTRANT Tech Street: 5335 GATE PKWY. Tech City: JACKSONVILLE Tech State/Province: FLORIDA Tech Postal Code: 32256 Tech Country: US Tech Phone: +1.8017659400 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: WHOIS@BLUEHOST.COM Name Server: NS1.BLUEHOST.COM Name Server: NS2.BLUEHOST.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-10-26T16:53:47Z |
| Server IP | 44.237.241.111 |
| Server Location | United States of America |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| healthfirstpharmacyservices.net | Available |
| healthfirstpharmacyservices.org | Already Registered |
| healthfirstpharmacyservices.biz | Already Registered |
| healthfirstpharmacyservices.io | Already Registered |
| healthfirstpharmacyservices.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| bealthfirstpharmacyservices.com | Available |
| gealthfirstpharmacyservices.com | Available |
| tealthfirstpharmacyservices.com | Available |
| yealthfirstpharmacyservices.com | Available |
| uealthfirstpharmacyservices.com | Available |
| Setindovip.com |
| Cookingsimulatorplay.com |
| Homekristina.com |
| Pibackround.com |
| Robinwoodgarden.com |
| Tiendaninci.com |
| Adaptskateboards.com |
| Picturesqueoccasions.com |
| Eugenedwhite.com |
| Hridyahboutique.com |